PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_39033
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-other
Protein Properties Length: 172aa    MW: 18549.5 Da    PI: 9.1887
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_39033genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.42.1e-123382257
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                + yps++ r+eL++k+gL++rq ++WF+ rR k++k
  PEQU_39033  3 ETYPSETLRAELSAKTGLSDRQLQMWFCHRRLKDRK 38
                57********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007112.26139IPR001356Homeobox domain
PfamPF000465.0E-10338IPR001356Homeobox domain
SuperFamilySSF466899.84E-10341IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-10438IPR009057Homeodomain-like
CDDcd000863.09E-10538No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
AVETYPSETL RAELSAKTGL SDRQLQMWFC HRRLKDRKFA PGKKAKKVEE PPSPPPPPPA  60
GREMIPPPPG NLSICPSAIP FPVGGGELRK AVARVSPAVS RLGADVSLAK RYYEQPIMAP  120
QPRQLSVLEL RIIASVEAQL GEPLRDDGPI LGVEFDPLPP GAFGAPIGIH ID
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924408.18e-58PREDICTED: uncharacterized protein LOC105047261 isoform X1
RefseqXP_010924410.17e-58PREDICTED: uncharacterized protein LOC105047261 isoform X3
TrEMBLM0TAJ32e-50M0TAJ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P26980_0016e-50(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1674079
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.11e-32homeobox-1